Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Taurine up-regulated 1 protein (TUG1), partial

This Recombinant Human Taurine up-regulated 1 protein (TUG1), partial spans the amino acid sequence from region 41-132. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Taurine up-regulated 1 protein TUG1

UniProt

A0A6I8PU40

Expression Region

41-132

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RPPRRAPGGRWRSRRVFLLVRRTRAAAYAFAIRRGVVRVVGGGGQLLRPAPGEAAAAAAAGFGAAGEAGVAGAGLEAWRHPSGPARTQLGGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Triacetin
BUP18518 1 g

Triacetin

Sign In for Pricing
View Details
TEX36 Rabbit Polyclonal Antibody
orb326919 100 µL

TEX36 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ENPP1, NT (ENPP1, M6S1, NPPS, PC1, PDNP1, Ectonucleotide pyrophosphatase/phosphodiesterase family member 1, Membrane component chromosome 6 surface marker 1, Phosphodiesterase I/nucleotide pyrophosphatase 1, Plasma-cell membrane glycoprotein PC-1, Alkaline phosphodiesterase I, Nucleotide pyrophosphatase) (APC) discontinued
035080-APC 200 µL

ENPP1, NT (ENPP1, M6S1, NPPS, PC1, PDNP1, Ectonucleotide pyrophosphatase/phosphodiesterase family member 1, Membrane component chromosome 6 surface marker 1, Phosphodiesterase I/nucleotide pyrophosphatase 1, Plasma-cell membrane glycoprotein PC-1, Alkaline phosphodiesterase I, Nucleotide pyrophosphatase) (APC) discontinued

Sign In for Pricing
View Details
ASH1L-IT1 Protein Vector (Human) (pPM-N-D-C-His)
PV324317 500 ng

ASH1L-IT1 Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details
BC006779 Protein Vector (Mouse) (pPM-C-HA)
13067024 500 ng

BC006779 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
NFATC4 3'UTR Lenti-reporter-Luc Vector
31765081 1.0 µg

NFATC4 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details