Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human UBAP1-MVB12-associated (UMAD1)

This Recombinant Human UBAP1-MVB12-associated (UMAD1) spans the amino acid sequence from region 1-137. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UBAP1-MVB12-associated; UMA-domain containing protein 1; RPA3 antisense RNA 1; RPA3 opposite strand; UMAD1 RPA3-AS1 RPA3OS

UniProt

C9J7I0

Expression Region

1-137

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MFHFFRKPPESKKPSVPETEADGFVLLGDTTDEQRMTARGKTSDIEANQPLETNKENSSSVTVSDPEMENKAGQTLENSSLMAELLSDVPFTLAPHVLAVQGTITDLPDHLLSYDGSENLSRFWYDFTLENSVLCDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KRR1, small subunit (SSU) processome component, homolog (KRR1) ELISA Kit
CK-bio-21631-01 48 Tests

Human KRR1, small subunit (SSU) processome component, homolog (KRR1) ELISA Kit

Sign In for Pricing
View Details
Human KRR1, small subunit (SSU) processome component, homolog (KRR1) ELISA Kit
CK-bio-21631-02 96 Tests

Human KRR1, small subunit (SSU) processome component, homolog (KRR1) ELISA Kit

Sign In for Pricing
View Details
KIR2DL3/KIR2DS2 Antibody
A17696-100UG 100 µg

KIR2DL3/KIR2DS2 Antibody

Sign In for Pricing
View Details
AQP1 Rabbit Monoclonal Antibody [Clone ID: 23GB1850]
TA424521S 20 µL

AQP1 Rabbit Monoclonal Antibody [Clone ID: 23GB1850]

Sign In for Pricing
View Details
Recombinant Mouse SLC35E3 Protein, His (Fc)-Avi-tagged
SLC35E3-8340M 50 µg

Recombinant Mouse SLC35E3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Canine CCR4 NOT transcription complex subunit 4 (CNOT4) ELISA kit
GTR10394711 96 Well

Canine CCR4 NOT transcription complex subunit 4 (CNOT4) ELISA kit

Sign In for Pricing
View Details