Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nuclear pore complex-interacting protein family member B4 (NPIB4), partial

This Recombinant Human Nuclear pore complex-interacting protein family member B4 (NPIB4), partial spans the amino acid sequence from region 1-62. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nuclear pore complex-interacting protein family member B4 NPIPB4

UniProt

C9JG80

Expression Region

1-62

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVKLSIVLTPQFLSHDQGQLTKELQQHVKSVTCPCEYLRKVINTLADHHHRGTDFGGSPWLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Chloro-2-Thiophenecarboxylic Acid 4-Nitrophenyl Ester
TRC-C424380-250MG 250 mg

5-Chloro-2-Thiophenecarboxylic Acid 4-Nitrophenyl Ester

Sign In for Pricing
View Details
PMM2 (NM_000303) Human Untagged Clone
SC119957 10 µg

PMM2 (NM_000303) Human Untagged Clone

Sign In for Pricing
View Details
Goose Shootin-1 (KIAA1598) ELISA Kit
MBS9942597 Inquire

Goose Shootin-1 (KIAA1598) ELISA Kit

Sign In for Pricing
View Details
Goat Anti-Rabbit Gamma Globulins Secondary Antibody
51-155-0100 100 mL

Goat Anti-Rabbit Gamma Globulins Secondary Antibody

Sign In for Pricing
View Details
Recombinant Human MIG (CXCL9)
7-02004 1 mg

Recombinant Human MIG (CXCL9)

Sign In for Pricing
View Details
H3FA (HIST1H3A) Rabbit Monoclonal Antibody
TA424135 100 µL

H3FA (HIST1H3A) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details