Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein PRAC2 (PRAC2)

This Recombinant Human Protein PRAC2 (PRAC2) spans the amino acid sequence from region 1-90. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein PRAC2; Prostate, rectum and colon expressed gene protein 2; PRAC2 C17orf93 HOXB-AS5 HOXB13-AS1 NCRNA00253

UniProt

D3DTV9

Expression Region

1-90

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDRRRMALRPGSRRPTAFFFHSRWLVPNLLAFFLGLSGAGPIHLPMPWPNGRRHRVLDPHTQLSTHEAPGRWKPVAPRTMKACPQVLLEW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-CDKN1B (Thr187) Rabbit Polyclonal Antibody (Cy5.5)
orb1045175 100 µL

Phospho-CDKN1B (Thr187) Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
HRAS (HRAS1, H-Ras-1, c-H-ras, C-Ha-Ras1, Ha-Ras, GTPase HRas, C-Bas/Has, CTLO, HAMSV, H-RASIDX, K-Ras, p21ras, RASH1, Transforming Protein p21) (HRP) discontinued
H8010-HRP 200 µL

HRAS (HRAS1, H-Ras-1, c-H-ras, C-Ha-Ras1, Ha-Ras, GTPase HRas, C-Bas/Has, CTLO, HAMSV, H-RASIDX, K-Ras, p21ras, RASH1, Transforming Protein p21) (HRP) discontinued

Sign In for Pricing
View Details
Human CD155/PVR Recombinant Protein, C-Fc
ARO-P18841-01 50 µg

Human CD155/PVR Recombinant Protein, C-Fc

Sign In for Pricing
View Details
Human CD155/PVR Recombinant Protein, C-Fc
ARO-P18841-02 100 µg

Human CD155/PVR Recombinant Protein, C-Fc

Sign In for Pricing
View Details
Human CD155/PVR Recombinant Protein, C-Fc
ARO-P18841-03 1 mg

Human CD155/PVR Recombinant Protein, C-Fc

Sign In for Pricing
View Details
Anti-Human CD243/P-Glycoprotein Antibody (C219), APC
HY466137-01 1 Each

Anti-Human CD243/P-Glycoprotein Antibody (C219), APC

Sign In for Pricing
View Details