Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uroplakin-3b-like protein 2 (UPKL2), partial

This Recombinant Human Uroplakin-3b-like protein 2 (UPKL2), partial spans the amino acid sequence from region 34-204. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uroplakin-3b-like protein 2 UPK3BL2

UniProt

E5RIL1

Expression Region

34-204

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GTDVAAPEHISYVPQLSNDTLAGRLTLSTFTLEQPLGQFSSHNISDLDTIWLVVALSNATQSFTAPRTNQDIPAPANFSQRGYYLTLRANRVLYQTRGQLHVLRVGNDTHCQPTKIGCNHPLPGPGPYRVKFLVMNDEGPVAETKWSSDTRLQQAQALRAVPGPQSPGTVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC342346 HDR Plasmid (h)
sc-415571-HDR 20 µg

LOC342346 HDR Plasmid (h)

Sign In for Pricing
View Details
Hamster Matrix Metalloproteinase 6 ELISA Kit
MBS007847-01 48 Well

Hamster Matrix Metalloproteinase 6 ELISA Kit

Sign In for Pricing
View Details
Hamster Matrix Metalloproteinase 6 ELISA Kit
MBS007847-02 96 Well

Hamster Matrix Metalloproteinase 6 ELISA Kit

Sign In for Pricing
View Details
Hamster Matrix Metalloproteinase 6 ELISA Kit
MBS007847-03 5x 96 Well

Hamster Matrix Metalloproteinase 6 ELISA Kit

Sign In for Pricing
View Details
Hamster Matrix Metalloproteinase 6 ELISA Kit
MBS007847-04 10x 96 Well

Hamster Matrix Metalloproteinase 6 ELISA Kit

Sign In for Pricing
View Details
CD127/IL7R Human Monoclonal Antibody (PerCP)
orb2971971-01 50 Tests

CD127/IL7R Human Monoclonal Antibody (PerCP)

Sign In for Pricing
View Details