Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 (TSTD3)

This Recombinant Human Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 (TSTD3) spans the amino acid sequence from region 1-97. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3; Rhodanese domain-containing protein 3; TSTD3

UniProt

H0UI37

Expression Region

1-97

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MKIEKCGWSEGLTSIKGNCHNFYTAISKDVTYKELKNLLNSKNIMLIDVREIWEILEYQKIPESINVPLDEVGEALQMNPRDFKEKYNEVKPSKSDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMD2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G6]
TA503217AM 100 µL

PSMD2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G6]

Sign In for Pricing
View Details
Slc15a1 Mouse Gene Knockout Kit (CRISPR)
KN515877 1 Kit

Slc15a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(R)-(+)-[1,1'-Binaphthalene]-2,2'-diamine
TRC-B387010-5G 5 g

(R)-(+)-[1,1'-Binaphthalene]-2,2'-diamine

Sign In for Pricing
View Details
L-Glucose-1-13C
TRC-G596506-25MG 25 mg

L-Glucose-1-13C

Sign In for Pricing
View Details
FISH (SH3PXD2A) Mouse Monoclonal Antibody [Clone ID: OTI4B8]
CF811759 100 µg

FISH (SH3PXD2A) Mouse Monoclonal Antibody [Clone ID: OTI4B8]

Sign In for Pricing
View Details
Recombinant Human Apolipoprotein H/ApoH Protein (His Tag)
PKSH032087-01 10 µg

Recombinant Human Apolipoprotein H/ApoH Protein (His Tag)

Sign In for Pricing
View Details