Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 46 (TEX46), partial

This Recombinant Human Testis-expressed protein 46 (TEX46), partial spans the amino acid sequence from region 37-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 46 TEX46 C1orf234

UniProt

H3BTG2

Expression Region

37-121

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LSNWLVKYEHKLTLPEPQQDEILQRLLFSEMKMKVLENQMFIIWNKMNHHGRSSRHRNFPMKKHRMRRHESICPTLSDCTSSSPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAPN8 Protein Vector (Mouse) (pPB-N-His)
PV161423 500 ng

CAPN8 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
CALM2 Polyclonal Antibody
A70680-100 100 µL

CALM2 Polyclonal Antibody

Sign In for Pricing
View Details
NUB1 Lentiviral Activation Particles (h)
sc-417483-LAC 200 µL

NUB1 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Human QSER1 shRNA Plasmid
abx962596-01 150 µg

Human QSER1 shRNA Plasmid

Sign In for Pricing
View Details
Human QSER1 shRNA Plasmid
abx962596-02 300 µg

Human QSER1 shRNA Plasmid

Sign In for Pricing
View Details
CD3 epsilon Rabbit Monoclonal Antibody
AMRe85403-01 1 Each

CD3 epsilon Rabbit Monoclonal Antibody

Sign In for Pricing
View Details