Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 179 (CC179)

This Recombinant Human Coiled-coil domain-containing protein 179 (CC179) spans the amino acid sequence from region 1-68. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 179 CCDC179

UniProt

H3BU77

Expression Region

1-68

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MCLYCWDIEPSQVNPEGPRQHHPSEVTERQLANKRIQNMQHLKKEKRRLNKRFSRPSPIPEPGLLWSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MBIP Protein (His Tag)
PKSH032739-01 10 µg

Recombinant Human MBIP Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human MBIP Protein (His Tag)
PKSH032739-02 50 µg

Recombinant Human MBIP Protein (His Tag)

Sign In for Pricing
View Details
Orbifloxacin
TRC-O674200-2.5G 2.5 g

Orbifloxacin

Sign In for Pricing
View Details
SNAP25 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI 1E6]
TA502965AM 100 µL

SNAP25 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI 1E6]

Sign In for Pricing
View Details
2-Ethyl N1,N3-Bis(descyclohexyl) N1,N3-Bis(trans-Cyclohexyl) Daprodustat 4-Dibenzoate
TRC-E193375-10MG 10 mg

2-Ethyl N1,N3-Bis(descyclohexyl) N1,N3-Bis(trans-Cyclohexyl) Daprodustat 4-Dibenzoate

Sign In for Pricing
View Details
Ethylmercury Chloride (Technical Grade)
TRC-E679555-25MG 25 mg

Ethylmercury Chloride (Technical Grade)

Sign In for Pricing
View Details