Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 179 (CC179)

This Recombinant Human Coiled-coil domain-containing protein 179 (CC179) spans the amino acid sequence from region 1-68. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 179 CCDC179

UniProt

H3BU77

Expression Region

1-68

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MCLYCWDIEPSQVNPEGPRQHHPSEVTERQLANKRIQNMQHLKKEKRRLNKRFSRPSPIPEPGLLWSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2494), Biotin conjugate, 0.1mg/mL
BNCB2494-500 1x 500 µL

FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2494), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary: right
CB501069 1 Block

Frozen Tissue Blocks, Ovary: right

Sign In for Pricing
View Details
SUN1 (NM_001171944) Human Over-expression Lysate
LC433423 20 µg

SUN1 (NM_001171944) Human Over-expression Lysate

Sign In for Pricing
View Details
FAM164B (ZC2HC1B) Human Gene Knockout Kit (CRISPR)
KN425272 1 Kit

FAM164B (ZC2HC1B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human KTI12 activation kit by CRISPRa
GA114382 1 Kit

Human KTI12 activation kit by CRISPRa

Sign In for Pricing
View Details
Ccser1 Mouse Gene Knockout Kit (CRISPR)
KN502847 1 Kit

Ccser1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details