Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 179 (CC179)

This Recombinant Human Coiled-coil domain-containing protein 179 (CC179) spans the amino acid sequence from region 1-68. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 179 CCDC179

UniProt

H3BU77

Expression Region

1-68

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MCLYCWDIEPSQVNPEGPRQHHPSEVTERQLANKRIQNMQHLKKEKRRLNKRFSRPSPIPEPGLLWSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OOTA00672-100UG - Mouse IgG2a Isotype Control : APC
OOTA00672-100UG 100 µg

OOTA00672-100UG - Mouse IgG2a Isotype Control : APC

Sign In for Pricing
View Details
TRIM14 (Tripartite Motif-containing Protein 14, KIAA0129) (APC)
134721-APC 100 µL

TRIM14 (Tripartite Motif-containing Protein 14, KIAA0129) (APC)

Sign In for Pricing
View Details
Recombinant Human UCN2 Protein, N-GST
orb2831868-01 20 µg

Recombinant Human UCN2 Protein, N-GST

Sign In for Pricing
View Details
Recombinant Human UCN2 Protein, N-GST
orb2831868-02 50 µg

Recombinant Human UCN2 Protein, N-GST

Sign In for Pricing
View Details
Recombinant Human UCN2 Protein, N-GST
orb2831868-03 100 µg

Recombinant Human UCN2 Protein, N-GST

Sign In for Pricing
View Details
Recombinant Shewanella baltica Large-conductance mechanosensitive channel (mscL), partial
MBS7068392 Inquire

Recombinant Shewanella baltica Large-conductance mechanosensitive channel (mscL), partial

Sign In for Pricing
View Details