Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-34 (CLD34), partial

This Recombinant Human Claudin-34 (CLD34), partial spans the amino acid sequence from region 33-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Claudin-34 CLDN34

UniProt

H7C241

Expression Region

33-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EWRIWYMKDTSLYPPGIACVGIFRVCIYRRRTNSTTTKFCYRYSYQDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Melanoma gp100 Antibody / PMEL17
orb2641376 100 µg

Melanoma gp100 Antibody / PMEL17

Sign In for Pricing
View Details
1-Ethyl-3-methylimidazolium diethyl phosphate
IL-0052-HP-0250 250 g

1-Ethyl-3-methylimidazolium diethyl phosphate

Sign In for Pricing
View Details
Igsf3 3'UTR Lenti-reporter-Luc Vector
24781086 1.0 µg

Igsf3 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
RBMS3 Antibody
orb1313412-01 30 µL

RBMS3 Antibody

Sign In for Pricing
View Details
RBMS3 Antibody
orb1313412-02 50 μL

RBMS3 Antibody

Sign In for Pricing
View Details
RBMS3 Antibody
orb1313412-03 100 µL

RBMS3 Antibody

Sign In for Pricing
View Details