Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-34 (CLD34), partial

This Recombinant Human Claudin-34 (CLD34), partial spans the amino acid sequence from region 33-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Claudin-34 CLDN34

UniProt

H7C241

Expression Region

33-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EWRIWYMKDTSLYPPGIACVGIFRVCIYRRRTNSTTTKFCYRYSYQDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC127 Protein Vector (Mouse) (pPM-C-HA)
15191024 500 ng

CCDC127 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
GCKR Recombinant Protein
OPCA02256-1MG 1 mg

GCKR Recombinant Protein

Sign In for Pricing
View Details
GAGE12I 3'UTR GFP Stable Cell Line
TU058505 1.0 mL

GAGE12I 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
MYCMI-6
BA2766-10 10 mg

MYCMI-6

Sign In for Pricing
View Details
anti-VAPB
YF-PA16162 100 ug

anti-VAPB

Sign In for Pricing
View Details
Canine Transmembrane Protein 174 (TMEM174) ELISA Kit
MBS9917187-01 48 Well

Canine Transmembrane Protein 174 (TMEM174) ELISA Kit

Sign In for Pricing
View Details