Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-34 (CLD34), partial

This Recombinant Human Claudin-34 (CLD34), partial spans the amino acid sequence from region 33-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Claudin-34 CLDN34

UniProt

H7C241

Expression Region

33-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EWRIWYMKDTSLYPPGIACVGIFRVCIYRRRTNSTTTKFCYRYSYQDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prohibitin (Mitochondrial Marker) (PHB/3226), CF740 conjugate, 0.1mg/mL
BNC743226-100 1x 100 µL

Prohibitin (Mitochondrial Marker) (PHB/3226), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RNH1 (Ribonuclease Inhibitor, Placental Ribonuclease Inhibitor, Placental RNase Inhibitor, Ribonuclease/Angiogenin Inhibitor 1, RAI, PRI, RNH) (MaxLight 405) discontinued
132707-ML405 100 µL

RNH1 (Ribonuclease Inhibitor, Placental Ribonuclease Inhibitor, Placental RNase Inhibitor, Ribonuclease/Angiogenin Inhibitor 1, RAI, PRI, RNH) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Rabbit Carbonic Anhydrase 6 (CA6) ELISA Kit
abx363158 96 Well

Rabbit Carbonic Anhydrase 6 (CA6) ELISA Kit

Sign In for Pricing
View Details
SYTL4 Antibody
DF4555-01 100 µL

SYTL4 Antibody

Sign In for Pricing
View Details
SYTL4 Antibody
DF4555-02 200 µL

SYTL4 Antibody

Sign In for Pricing
View Details
Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) ERV14 Polyclonal Antibody
MBS7160012 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) ERV14 Polyclonal Antibody

Sign In for Pricing
View Details