Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-34 (CLD34), partial

This Recombinant Human Claudin-34 (CLD34), partial spans the amino acid sequence from region 33-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Claudin-34 CLDN34

UniProt

H7C241

Expression Region

33-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EWRIWYMKDTSLYPPGIACVGIFRVCIYRRRTNSTTTKFCYRYSYQDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ISO20560PM-165X60-SALPETERZUUR Pipe Markers for Gases
316688 1 Pack (1 Marker (s) x 1 Card)

ISO20560PM-165X60-SALPETERZUUR Pipe Markers for Gases

Sign In for Pricing
View Details
PerCP-Cy5.5 Anti-Human CD158b/j Antibody (DX27)
PCP55-30251-01 20 Tests

PerCP-Cy5.5 Anti-Human CD158b/j Antibody (DX27)

Sign In for Pricing
View Details
PerCP-Cy5.5 Anti-Human CD158b/j Antibody (DX27)
PCP55-30251-02 100 Tests

PerCP-Cy5.5 Anti-Human CD158b/j Antibody (DX27)

Sign In for Pricing
View Details
1- (4-bromo-1-isopropyl-1H-pyrazol-5-yl) ethanol
OR1084313-01 250 mg

1- (4-bromo-1-isopropyl-1H-pyrazol-5-yl) ethanol

Sign In for Pricing
View Details
1- (4-bromo-1-isopropyl-1H-pyrazol-5-yl) ethanol
OR1084313-02 500 mg

1- (4-bromo-1-isopropyl-1H-pyrazol-5-yl) ethanol

Sign In for Pricing
View Details
1- (4-bromo-1-isopropyl-1H-pyrazol-5-yl) ethanol
OR1084313-03 1 g

1- (4-bromo-1-isopropyl-1H-pyrazol-5-yl) ethanol

Sign In for Pricing
View Details