Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein ZNF561-AS1 (CS082)

This Recombinant Human Uncharacterized protein ZNF561-AS1 (CS082) spans the amino acid sequence from region 1-104. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein ZNF561-AS1; ZNF561 antisense RNA 1; ZNF561 antisense gene protein 1; ZNF561-AS1 C19orf82

UniProt

K7EIQ3

Expression Region

1-104

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGRIPGGCSSKAFIGRAQWLTPVIPALWEAKGLTLLSRLECSDVIMDHCSPQLTGLRMKGFLAQTPPLEFPVHQYQPGDHVLIKSWKRESLNQLRRTSSGTLDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pannexin-3 Overexpression Lysate - (Dry Ice)
NBP2-05832 0.1 mg

Pannexin-3 Overexpression Lysate - (Dry Ice)

Sign In for Pricing
View Details
Recombinant Human ADH7 (C-6His)
C882-01 10 µg

Recombinant Human ADH7 (C-6His)

Sign In for Pricing
View Details
Recombinant Human ADH7 (C-6His)
C882-02 50 µg

Recombinant Human ADH7 (C-6His)

Sign In for Pricing
View Details
Recombinant Human ADH7 (C-6His)
C882-03 500 µg

Recombinant Human ADH7 (C-6His)

Sign In for Pricing
View Details
Recombinant Human ADH7 (C-6His)
C882-04 1 mg

Recombinant Human ADH7 (C-6His)

Sign In for Pricing
View Details
Troponin I-cardiac (region 24-40)
MBS319676-01 1 mg

Troponin I-cardiac (region 24-40)

Sign In for Pricing
View Details