Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 18 (SIM18), partial

This Recombinant Human Small integral membrane protein 18 (SIM18), partial spans the amino acid sequence from region 56-95. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 18 SMIM18

UniProt

P0DKX4

Expression Region

56-95

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YEVLDCCCCVKNKTVKDLKSEPNPLRSMMDNIRKRETEVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2831R), CF640R conjugate, 0.1mg/mL
BNC402831-100 1x 100 µL

DOG-1 / TMEM16A (Gastrointestinal Stromal Tumor Marker) (DG1/2831R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TECPR2 (NM_001172631) Human Over-expression Lysate
LC433686 20 µg

TECPR2 (NM_001172631) Human Over-expression Lysate

Sign In for Pricing
View Details
Human DAP5 (EIF4G2) activation kit by CRISPRa
GA101373 1 Kit

Human DAP5 (EIF4G2) activation kit by CRISPRa

Sign In for Pricing
View Details
ExoBriteTM 555/575 True EV Membrane Stain, 100 labelings
#30130-T 1x 100 µL

ExoBriteTM 555/575 True EV Membrane Stain, 100 labelings

Sign In for Pricing
View Details
GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2391), CF647 conjugate, 0.1mg/mL
BNC472391-100 1x 100 µL

GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2391), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Rat CD44H Antibody[OX-49]
E-AB-F1225H-01 50 Tests

PE/Cyanine7 Anti-Rat CD44H Antibody[OX-49]

Sign In for Pricing
View Details