Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proline-rich protein 23D2 (P23D2)

This Recombinant Human Proline-rich protein 23D2 (P23D2) spans the amino acid sequence from region 1-279. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Proline-rich protein 23D2 PRR23D2

UniProt

P0DMB1

Expression Region

1-279

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MYGYRRLRSPRDSQTEPQNDNEGETSLATTQMNPPKRRQVEQGPSTGAKKPSISGAPHLNSYQSLELPQNQQDSGTEELMIVLEQGTEVRLSLEEVILILAPETVLQLTLENTVLVIVPEHVLRSEDGLQSPVQIQYIIPSVDDFSLEFHAQDGDISDMRRENVPFSPAEEGKAAPLYQQPLMIPQANHMAGISPSFLVTPLCIPRCRAAFPQCYPLPPTPSPVGRPRPADSSFSLHGMELLCTSSLRPMPPSPSPGPQVYHRVHHRPPSRARRCLFRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/1283), 0.2mg/mL
BNUB1283-500 1x 500 µL

VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/1283), 0.2mg/mL

Sign In for Pricing
View Details
Cell Meter™ Cell Viability Assay Kit *Blue Fluorescence*
22785-AAT 500 Tests

Cell Meter™ Cell Viability Assay Kit *Blue Fluorescence*

Sign In for Pricing
View Details
6-Amino-1,3-dibutyl-5-nitroso-2,4(1H,3H)-pyrimidinedione
TRC-A604620-250MG 250 mg

6-Amino-1,3-dibutyl-5-nitroso-2,4(1H,3H)-pyrimidinedione

Sign In for Pricing
View Details
ME2 (C-term) Rabbit Polyclonal Antibody
AP52647PU-N 400 µL

ME2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cell Navigator® Cell Plasma Membrane Staining Kit *Orange Fluorescence*
22680-AAT 500 Tests

Cell Navigator® Cell Plasma Membrane Staining Kit *Orange Fluorescence*

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS706669 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details