Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proline-rich protein 23D2 (P23D2)

This Recombinant Human Proline-rich protein 23D2 (P23D2) spans the amino acid sequence from region 1-279. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Proline-rich protein 23D2 PRR23D2

UniProt

P0DMB1

Expression Region

1-279

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MYGYRRLRSPRDSQTEPQNDNEGETSLATTQMNPPKRRQVEQGPSTGAKKPSISGAPHLNSYQSLELPQNQQDSGTEELMIVLEQGTEVRLSLEEVILILAPETVLQLTLENTVLVIVPEHVLRSEDGLQSPVQIQYIIPSVDDFSLEFHAQDGDISDMRRENVPFSPAEEGKAAPLYQQPLMIPQANHMAGISPSFLVTPLCIPRCRAAFPQCYPLPPTPSPVGRPRPADSSFSLHGMELLCTSSLRPMPPSPSPGPQVYHRVHHRPPSRARRCLFRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAMA3 Antibody
8C13066-AAT 50 µg

LAMA3 Antibody

Sign In for Pricing
View Details
DL-Tyrosine
TRC-D525378-50MG 50 mg

DL-Tyrosine

Sign In for Pricing
View Details
MiTF Recombinant Rabbit monoclonal Antibody
HA750362 100 µL

MiTF Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Srcin1 Mouse Gene Knockout Kit (CRISPR)
KN516699 1 Kit

Srcin1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Thbd Mouse Gene Knockout Kit (CRISPR)
KN517516 1 Kit

Thbd Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cystatin A (CPTC-CSTA-1), CF405S conjugate, 0.1mg/mL
BNC042236-100 1x 100 µL

Cystatin A (CPTC-CSTA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details