Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proline-rich protein 23D2 (P23D2)

This Recombinant Human Proline-rich protein 23D2 (P23D2) spans the amino acid sequence from region 1-279. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Proline-rich protein 23D2 PRR23D2

UniProt

P0DMB1

Expression Region

1-279

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MYGYRRLRSPRDSQTEPQNDNEGETSLATTQMNPPKRRQVEQGPSTGAKKPSISGAPHLNSYQSLELPQNQQDSGTEELMIVLEQGTEVRLSLEEVILILAPETVLQLTLENTVLVIVPEHVLRSEDGLQSPVQIQYIIPSVDDFSLEFHAQDGDISDMRRENVPFSPAEEGKAAPLYQQPLMIPQANHMAGISPSFLVTPLCIPRCRAAFPQCYPLPPTPSPVGRPRPADSSFSLHGMELLCTSSLRPMPPSPSPGPQVYHRVHHRPPSRARRCLFRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROCK1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-1166R-BF555-01 20 µL

ROCK1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
ROCK1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-1166R-BF555-02 100 µL

ROCK1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
EMILIN-1 Lentiviral Activation Particles (m)
sc-430348-LAC 200 µL

EMILIN-1 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
FARS2 (FARS1, Phenylalanine-tRNA Ligase, Mitochondrial, Phenylalanyl-tRNA Synthetase) (Biotin)
126631-Biotin 100 µL

FARS2 (FARS1, Phenylalanine-tRNA Ligase, Mitochondrial, Phenylalanyl-tRNA Synthetase) (Biotin)

Sign In for Pricing
View Details
Porcine Transmembrane protease serine 12 ELISA kit
GTR10467992 96 Well

Porcine Transmembrane protease serine 12 ELISA kit

Sign In for Pricing
View Details
RSPH14 Antibody - middle region : FITC (ARP55056_P050-FITC)
ARP55056_P050-FITC 100 µL

RSPH14 Antibody - middle region : FITC (ARP55056_P050-FITC)

Sign In for Pricing
View Details