Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C8orf88 (CH088)

This Recombinant Human Uncharacterized protein C8orf88 (CH088) spans the amino acid sequence from region 1-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C8orf88 C8orf88

UniProt

P0DMB2

Expression Region

1-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

METKKLIGKPLQPARPVRHLTSPPGAVFPFNFQNEYPCNTQCIQSGVSRCKTNGMQAFSQGLNEQQQQQSPVKKERIKYSRDFLLKLSSVSICRKKPDFLPDHPIVLQKPENNQSFK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Platelet Derived Growth Factor Receptor, alpha (Platelet-derived Growth Factor Receptor alpha, PDGFR alpha, PDGF-R-alpha, PDGFRa, PDGFR-A, Alpha Platelet-derived Growth Factor Receptor, CD140a, CD140a Antigen, MGC74795, PDGF alpha Chain, Platelet-derived Growth Factor Receptor 2, PDGFR2, PDGFR-2) (MaxLight 550) discontinued
P4258-03N-ML550 100 µL

Platelet Derived Growth Factor Receptor, alpha (Platelet-derived Growth Factor Receptor alpha, PDGFR alpha, PDGF-R-alpha, PDGFRa, PDGFR-A, Alpha Platelet-derived Growth Factor Receptor, CD140a, CD140a Antigen, MGC74795, PDGF alpha Chain, Platelet-derived Growth Factor Receptor 2, PDGFR2, PDGFR-2) (MaxLight 550) discontinued

Sign In for Pricing
View Details
MID1 (NM_001098624) Human Tagged ORF Clone
RG213454 10 µg

MID1 (NM_001098624) Human Tagged ORF Clone

Sign In for Pricing
View Details
Monkey Olfactory receptor 12D3 (OR12D3) ELISA kit
GTR10459132 96 Well

Monkey Olfactory receptor 12D3 (OR12D3) ELISA kit

Sign In for Pricing
View Details
GABA A Receptor A2 (CT) (PE) discontinued
G1015-07D-PE 100 µL

GABA A Receptor A2 (CT) (PE) discontinued

Sign In for Pricing
View Details
KCNMB3 Rabbit pAb, AP conjugated
orb2852174 100 µL

KCNMB3 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
HUNK (Hormonally Up-regulated Neu Tumor-Associated Kinase, B19, MAKV, Serine/threonine-protein Kinase MAK-V) (MaxLight 550)
128165-ML550 100 µL

HUNK (Hormonally Up-regulated Neu Tumor-Associated Kinase, B19, MAKV, Serine/threonine-protein Kinase MAK-V) (MaxLight 550)

Sign In for Pricing
View Details