Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative transmembrane protein INAFM2 (INAM2), partial

This Recombinant Human Putative transmembrane protein INAFM2 (INAM2), partial spans the amino acid sequence from region 57-153. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative transmembrane protein INAFM2; InaF-motif-containing protein 2; Osteogenesis up-regulated transcript 1; INAFM2 LINC00984 OGU1

UniProt

P0DMQ5

Expression Region

57-153

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YSLIWQPVGAGTSGGAAGPPPGGSNATGPSGTSGAAAAGPNTTGSSRREAPRDVPPLQAARPAPPEPPADSPPAGPLERPRGPDEDEEETAAAPGSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

alpha-Naphthol Orange
TRC-N369040-500MG 500 mg

alpha-Naphthol Orange

Sign In for Pricing
View Details
Human TRMT6 activation kit by CRISPRa
GA109898 1 Kit

Human TRMT6 activation kit by CRISPRa

Sign In for Pricing
View Details
CA13 (NM_198584) Human Recombinant Protein
TP720089 10 µg

CA13 (NM_198584) Human Recombinant Protein

Sign In for Pricing
View Details
Human ACV-A Antibody Pair Set
E-KAB-0647 50 µL & 100 µg

Human ACV-A Antibody Pair Set

Sign In for Pricing
View Details
Hsp40 (DNAJB1) (1-340) Mouse Monoclonal Antibody [Clone ID: k1C7]
AM05642PU-S 50 µL

Hsp40 (DNAJB1) (1-340) Mouse Monoclonal Antibody [Clone ID: k1C7]

Sign In for Pricing
View Details
Recombinant Trefoil Factor 3 Antibody
RC-15979-01 50 μL

Recombinant Trefoil Factor 3 Antibody

Sign In for Pricing
View Details