Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative protein T-ENOL (ENOL)

This Recombinant Human Putative protein T-ENOL (ENOL) spans the amino acid sequence from region 1-83. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative protein T-ENOL; CDIP transferase opposite strand, pseudogene; CDIPT antisense RNA 1; CDIPTOSP CDIPT-AS1 T-ENOL

UniProt

P0DO92

Expression Region

1-83

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MASTPMGNEGEKKSSWPSQAAPSLRGGPASLSRSEEYLSQISAELMEEALCTACCHLNPVPIKKKQSQDQATQISKRAFFTKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PerCP Anti-Rat CD4 (domain 1) Antibody[OX-38]
E-AB-F1105UF-01 25 µg

PerCP Anti-Rat CD4 (domain 1) Antibody[OX-38]

Sign In for Pricing
View Details
PerCP Anti-Rat CD4 (domain 1) Antibody[OX-38]
E-AB-F1105UF-02 100 µg

PerCP Anti-Rat CD4 (domain 1) Antibody[OX-38]

Sign In for Pricing
View Details
Galanin (GAL) Human Gene Knockout Kit (CRISPR)
KN207053RB 1 Kit

Galanin (GAL) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tezepelumab Biosimilar - Research Grade
ICH5213-5mg 5 mg

Tezepelumab Biosimilar - Research Grade

Sign In for Pricing
View Details
CUTA (NM_015921) Human Recombinant Protein
TP319077M 100 µg

CUTA (NM_015921) Human Recombinant Protein

Sign In for Pricing
View Details
BMERB1 (NM_001142469) Human Over-expression Lysate
LY428115 100 µg

BMERB1 (NM_001142469) Human Over-expression Lysate

Sign In for Pricing
View Details