Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative protein T-ENOL (ENOL)

This Recombinant Human Putative protein T-ENOL (ENOL) spans the amino acid sequence from region 1-83. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative protein T-ENOL; CDIP transferase opposite strand, pseudogene; CDIPT antisense RNA 1; CDIPTOSP CDIPT-AS1 T-ENOL

UniProt

P0DO92

Expression Region

1-83

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MASTPMGNEGEKKSSWPSQAAPSLRGGPASLSRSEEYLSQISAELMEEALCTACCHLNPVPIKKKQSQDQATQISKRAFFTKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TentaGel® M RAM
M303023.5G 5 g

TentaGel® M RAM

Sign In for Pricing
View Details
Cinchophen
TRC-C441915-25G 25 g

Cinchophen

Sign In for Pricing
View Details
Titanium Dioxide
TRC-T446775-1G 1 g

Titanium Dioxide

Sign In for Pricing
View Details
Human ZNF280D activation kit by CRISPRa
GA110283 1 Kit

Human ZNF280D activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant FABP4 Monoclonal Antibody
AN301047L-01 50 µL

Recombinant FABP4 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant FABP4 Monoclonal Antibody
AN301047L-02 100 µL

Recombinant FABP4 Monoclonal Antibody

Sign In for Pricing
View Details