Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein CXorf51B (CX05B)

This Recombinant Human Uncharacterized protein CXorf51B (CX05B) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein CXorf51B CXorf51B

UniProt

P0DPH9

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAKVTSEPQKPNEDVDEQTPSTSSTKGRKKGKTPRQRRSRSGVKGLKTTRKAKRPLRGSSSQKAGETNTPAGKPKKARGPILRGRYHRLKEKMKKEEADKEQSETSVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEDD Human Gene Knockout Kit (CRISPR)
KN400590 1 Kit

DEDD Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Phospho-GCN2 (T899) Recombinant Rabbit Monoclonal Antibody [JE00-51]
HA722249 100 µL

Phospho-GCN2 (T899) Recombinant Rabbit Monoclonal Antibody [JE00-51]

Sign In for Pricing
View Details
2-Fluoroiodobenzene
TRC-F591990-25G 25 g

2-Fluoroiodobenzene

Sign In for Pricing
View Details
CD79a (IGA/1688R), CF647 conjugate, 0.1mg/mL
BNC471688-100 1x 100 µL

CD79a (IGA/1688R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1,4-Dioxane-2,5-dione
TRC-D485883-5G 5 g

1,4-Dioxane-2,5-dione

Sign In for Pricing
View Details
CDK8 (NM_001260) Human Recombinant Protein
TP312592M 100 µg

CDK8 (NM_001260) Human Recombinant Protein

Sign In for Pricing
View Details