Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative taste receptor type 2 member 33 (T2R33), partial

This Recombinant Human Putative taste receptor type 2 member 33 (T2R33), partial spans the amino acid sequence from region 149-181. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative taste receptor type 2 member 33; T2R33; hGR33; TAS2R33

UniProt

P0DSN6

Expression Region

149-181

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDERVWTKEYEGNVTWKIKLRNAIHLSSLTVTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRITC-Polysucrose 400kDa, 1g
CTP400-1g 1 g

TRITC-Polysucrose 400kDa, 1g

Sign In for Pricing
View Details
AFP Protein
30R-3419 1 mg

AFP Protein

Sign In for Pricing
View Details
Lentiviral mouse Neil2 shRNA (UAS) - Lentiviral mouse Neil2 shRNA (UAS, RFP) (25)
GTR15135935 1 Vial

Lentiviral mouse Neil2 shRNA (UAS) - Lentiviral mouse Neil2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
ATG10 Antibody
orb36542-01 50 µg

ATG10 Antibody

Sign In for Pricing
View Details
ATG10 Antibody
orb36542-02 100 µg

ATG10 Antibody

Sign In for Pricing
View Details
Synaptic Vesicle Membrane Protein VAT-1 Homolog-Like (VAT1L) Antibody
abx027216-01 80 µL

Synaptic Vesicle Membrane Protein VAT-1 Homolog-Like (VAT1L) Antibody

Sign In for Pricing
View Details