Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G antigen 4 (GAGE4)

This Recombinant Human G antigen 4 (GAGE4) spans the amino acid sequence from region 1-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

G antigen 4; Cancer/testis antigen 4.4; CT4.4; GAGE4

UniProt

P0DSO3

Expression Region

1-117

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JUNB Antibody
orb689212-01 50 μL

JUNB Antibody

Sign In for Pricing
View Details
JUNB Antibody
orb689212-02 100 µL

JUNB Antibody

Sign In for Pricing
View Details
SMAD3 (SMAD Family Member 3, DKFZp586N0721, DKFZp686J10186, HSPC193, HsT17436, JV15-2, MADH3, MGC60396) (HRP)
251789-HRP 100 µL

SMAD3 (SMAD Family Member 3, DKFZp586N0721, DKFZp686J10186, HSPC193, HsT17436, JV15-2, MADH3, MGC60396) (HRP)

Sign In for Pricing
View Details
Mouse Septin2 qPCR Primer Pair
QM17654S 200 Tests

Mouse Septin2 qPCR Primer Pair

Sign In for Pricing
View Details
PDK2 Conjugated Antibody
C49827 100 µL

PDK2 Conjugated Antibody

Sign In for Pricing
View Details
EPAS1/HIF2α Rabbit pAb
E45R27494N-100 100 µL

EPAS1/HIF2α Rabbit pAb

Sign In for Pricing
View Details