Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G antigen 4 (GAGE4)

This Recombinant Human G antigen 4 (GAGE4) spans the amino acid sequence from region 1-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

G antigen 4; Cancer/testis antigen 4.4; CT4.4; GAGE4

UniProt

P0DSO3

Expression Region

1-117

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MASP1 3'UTR Luciferase Stable Cell Line
TU013039 1.0 mL

MASP1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
PPP6C Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV677579 1.0 µg DNA

PPP6C Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
6-Bromo-4-methoxypyrazolo[1,5-a]pyridine-3-carbonitrile
T77685 200 mg

6-Bromo-4-methoxypyrazolo[1,5-a]pyridine-3-carbonitrile

Sign In for Pricing
View Details
Proteasome subunit β type-6 (PSMB6) Mouse ELISA Kit
G2299 96 Tests

Proteasome subunit β type-6 (PSMB6) Mouse ELISA Kit

Sign In for Pricing
View Details
DCX (Doublecortin, DBCN, DC, LISX, SCLH, XLIS) (PE)
245230-PE 100 µL

DCX (Doublecortin, DBCN, DC, LISX, SCLH, XLIS) (PE)

Sign In for Pricing
View Details
Human Rubella Virus (RV) IgG ELISA Kit
E-HD-E032-01 96 Tests

Human Rubella Virus (RV) IgG ELISA Kit

Sign In for Pricing
View Details