Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphocyte antigen 6S (LY6S)

This Recombinant Human Lymphocyte antigen 6S (LY6S) spans the amino acid sequence from region 27-105. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lymphocyte antigen 6S LY6S

UniProt

P0DTL4

Expression Region

27-105

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LRCYRCLAVLEGASCSVVSCPFLDGVCVSQKVSVFGSKVRGENKLSLLSCQKDVGFPLLKLTSAVVDSQISCCKGDLCN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2810021B07Rik Protein Vector (Mouse) (pPB-N-His)
PV148527 500 ng

2810021B07Rik Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Canine IL3RA Protein, His Tag
PCA171 20 µg

Canine IL3RA Protein, His Tag

Sign In for Pricing
View Details
Mouse Rfesd Pre-designed siRNA Set B
SI111895B 1 Each

Mouse Rfesd Pre-designed siRNA Set B

Sign In for Pricing
View Details
RPEL1 Human Over-expression Lysate
orb1340434 100 µg

RPEL1 Human Over-expression Lysate

Sign In for Pricing
View Details
PDX1 Mouse Monoclonal Antibody [Clone ID: LBI5D5]
AMM08931VCF 100 µg

PDX1 Mouse Monoclonal Antibody [Clone ID: LBI5D5]

Sign In for Pricing
View Details
Rat Semaphorin 3A (SEMA3A) ELISA Kit
DL-SEMA3A-Ra-01 48 Tests

Rat Semaphorin 3A (SEMA3A) ELISA Kit

Sign In for Pricing
View Details