Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Speedy protein E12 (SPD12)

This Recombinant Human Speedy protein E12 (SPD12) spans the amino acid sequence from region 1-265. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Speedy protein E12 SPDYE12 SPDYE12P

UniProt

P0DUX1

Expression Region

1-265

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGQILGKIMMSHQPQPQEEQSPQRSTSGYPLQEVVDDEVSGPSAPGVDPSPPRRSLGWKRKRECLDESDDEPEKELAPEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLLEDPVIKRLLAWDKDLRVSDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEAPKQNIFYFLYEETRSHIPLLRELWFQLCRYMNPRARKNCSQIALFRKYRFHFFCSMRCRAWVSLEELEEIQAYDPEHWVWARDRAHLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Sedoheptulokinase Recombinant Protein C-6 His Tag
MBS8433349-01 0.05 mg

Human Sedoheptulokinase Recombinant Protein C-6 His Tag

Sign In for Pricing
View Details
Human Sedoheptulokinase Recombinant Protein C-6 His Tag
MBS8433349-02 5x 0.05 mg

Human Sedoheptulokinase Recombinant Protein C-6 His Tag

Sign In for Pricing
View Details
TMEM133 Protein Vector (Human) (pPM-C-HA)
PV135980 500 ng

TMEM133 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Anti-NRF2 (Acetyl-K599) Antibody
CPA7244-01 30 µL

Anti-NRF2 (Acetyl-K599) Antibody

Sign In for Pricing
View Details
Anti-NRF2 (Acetyl-K599) Antibody
CPA7244-02 50 μL

Anti-NRF2 (Acetyl-K599) Antibody

Sign In for Pricing
View Details
Anti-NRF2 (Acetyl-K599) Antibody
CPA7244-03 100 µL

Anti-NRF2 (Acetyl-K599) Antibody

Sign In for Pricing
View Details