Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative chemokine-related protein B42 (CCB42)

This Recombinant Human Putative chemokine-related protein B42 (CCB42) spans the amino acid sequence from region 1-81. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative chemokine-related protein B42

UniProt

Q1T7F1

Expression Region

1-81

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPLSDWCCGICEEAPLGRAYTQTWMETGCGPHGVTALGQQELKDCLRARSGGTASSVDWIMEAARGSLNVHNCLIKFGRRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MID1 Human qPCR Template Standard (NM_033290)
HK204745 1 Kit

MID1 Human qPCR Template Standard (NM_033290)

Sign In for Pricing
View Details
Dog Angiopoietin-2 (ANGPT2) ELISA Kit
abx511354 96 Tests

Dog Angiopoietin-2 (ANGPT2) ELISA Kit

Sign In for Pricing
View Details
SensiStain Anti-Recombinant D-dimer Antibody
MBS4160521-01 0.1 mL

SensiStain Anti-Recombinant D-dimer Antibody

Sign In for Pricing
View Details
SensiStain Anti-Recombinant D-dimer Antibody
MBS4160521-02 5x 0.1 mL

SensiStain Anti-Recombinant D-dimer Antibody

Sign In for Pricing
View Details
Pgap4 Mouse siRNA Oligo Duplex (Locus ID 67063)
SR413430 1 Kit

Pgap4 Mouse siRNA Oligo Duplex (Locus ID 67063)

Sign In for Pricing
View Details
Lentiviral human TSPAN10 shRNA (UAS) - Lentiviral human TSPAN10 shRNA (UAS, RFP) (100)
GTR15282312 1 Vial

Lentiviral human TSPAN10 shRNA (UAS) - Lentiviral human TSPAN10 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details