Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis development-related protein 1 (TDRG1)

This Recombinant Human Testis development-related protein 1 (TDRG1) spans the amino acid sequence from region 1-100. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis development-related protein 1 TDRG1

UniProt

Q3Y452

Expression Region

1-100

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MKRREAVCAHRHFLGTGKPPHPLGRSIPVEPCPGLPAFAEVDLLSLLVPIKISSTPPSGSRLDPQIASSAFPGLGSLGGQDSSGSLVQRASCELESPYEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRMD6 Double Nickase Plasmid (m2)
sc-435657-NIC-2 20 µg

FRMD6 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
FRMD3 Protein Vector (Rat) (pPB-N-His)
PV269031 500 ng

FRMD3 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Calprotectin / MRP14 / S100A9 / Calgranulin B (rMAC3781), CF568 conjugate, 0.1mg/mL
BNC683781-100 1x 100 µL

Calprotectin / MRP14 / S100A9 / Calgranulin B (rMAC3781), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fbxo21 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4269005 3x 1.0 µg

Fbxo21 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Anti-FLIP (NT) Antibody
1159 100ug

Anti-FLIP (NT) Antibody

Sign In for Pricing
View Details
MRX15 3'UTR Lenti-reporter-Luc Vector
30642081 1.0 µg

MRX15 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details