Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis development-related protein 1 (TDRG1)

This Recombinant Human Testis development-related protein 1 (TDRG1) spans the amino acid sequence from region 1-100. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis development-related protein 1 TDRG1

UniProt

Q3Y452

Expression Region

1-100

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MKRREAVCAHRHFLGTGKPPHPLGRSIPVEPCPGLPAFAEVDLLSLLVPIKISSTPPSGSRLDPQIASSAFPGLGSLGGQDSSGSLVQRASCELESPYEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse IL-13 CF
413-mL-025/CF 25 µg

Recombinant Mouse IL-13 CF

Sign In for Pricing
View Details
Lyc2 (NM_001128494) Rat Tagged ORF Clone Lentiviral Particle
RR214188L3V 200 µL

Lyc2 (NM_001128494) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
HDAC6 Mouse Monoclonal Antibody [Clone ID: LBI1D10]
AMM10519VCF 100 µg

HDAC6 Mouse Monoclonal Antibody [Clone ID: LBI1D10]

Sign In for Pricing
View Details
ELISA Kit For E3 UFM1-protein ligase 1
E4457r 96 Tests

ELISA Kit For E3 UFM1-protein ligase 1

Sign In for Pricing
View Details
Tmem218 Mouse shRNA Lentiviral Particle (Locus ID 66279)
TL503579V 500 µL Each

Tmem218 Mouse shRNA Lentiviral Particle (Locus ID 66279)

Sign In for Pricing
View Details
Anti-Fundulus heteroclitus (Killifish) Serine/threonine-protein kinase Antibody FITC Conjugated
DZ41662-FITC 200 µL/Vial

Anti-Fundulus heteroclitus (Killifish) Serine/threonine-protein kinase Antibody FITC Conjugated

Sign In for Pricing
View Details