Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 7 (SMIM7), partial

This Recombinant Human Small integral membrane protein 7 (SMIM7), partial spans the amino acid sequence from region 18-53. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 7 SMIM7 C19orf42

UniProt

Q9BQ49

Expression Region

18-53

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VLNFKLKKKDTQGFGEESREPSTGDNIREFLLSLRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Rb (Ser811) Rabbit mAb
E2R25558 100 µL

Phospho-Rb (Ser811) Rabbit mAb

Sign In for Pricing
View Details
9-place (3 long x 3 high) upright freezer sliding rack for 2 in H boxes, 16 1/2 in L x 5 1/2 in W x 7 1/8 in H, stainless steel
2632-3300 1 Each

9-place (3 long x 3 high) upright freezer sliding rack for 2 in H boxes, 16 1/2 in L x 5 1/2 in W x 7 1/8 in H, stainless steel

Sign In for Pricing
View Details
Envelope glycoprotein Antibody
orb843050 2 mg

Envelope glycoprotein Antibody

Sign In for Pricing
View Details
Research Grade Anti-Human CD318/CDCP1 (25A11)
DHJ57502 100 μg

Research Grade Anti-Human CD318/CDCP1 (25A11)

Sign In for Pricing
View Details
TADA1 Protein Vector (Mouse) (pPB-N-His)
PV236083 500 ng

TADA1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
TGF beta Receptor I  Rabbit pAb
E45R23459N 50 ul

TGF beta Receptor I Rabbit pAb

Sign In for Pricing
View Details