Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 7 (SMIM7), partial

This Recombinant Human Small integral membrane protein 7 (SMIM7), partial spans the amino acid sequence from region 18-53. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 7 SMIM7 C19orf42

UniProt

Q9BQ49

Expression Region

18-53

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VLNFKLKKKDTQGFGEESREPSTGDNIREFLLSLRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Kallikrein 8 ELISA kit
GTR10417923 96 Well

Rat Kallikrein 8 ELISA kit

Sign In for Pricing
View Details
ANXA9 (NM_003568) Human Over-expression Lysate
LS008416-100ug 100 µg

ANXA9 (NM_003568) Human Over-expression Lysate

Sign In for Pricing
View Details
Alexa Fluor® 647 anti-mouse CD206 (MMR)
E16FMK206-100U 100 µg

Alexa Fluor® 647 anti-mouse CD206 (MMR)

Sign In for Pricing
View Details
mmu-miR-7047-5p miRNA Inhibitor
MIM02864 2x 5.0 nmol

mmu-miR-7047-5p miRNA Inhibitor

Sign In for Pricing
View Details
4- (2-Bromoallyl) -1,2-difluorobenzene
PC2371 1 Each

4- (2-Bromoallyl) -1,2-difluorobenzene

Sign In for Pricing
View Details
VDAC Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-1461R-APC-Cy5.5 100 µL

VDAC Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details