Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Ciliary microtubule inner protein 3 (CMIP3)

This Recombinant Human Ciliary microtubule inner protein 3 (CMIP3) spans the amino acid sequence from region 1-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ciliary microtubule inner protein 3; GUCA1A neighbor; CIMIP3 GUCA1ANB

UniProt

X6R8D5

Expression Region

1-112

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MCKDSQKPSVPSHGPKTPSCKGVKAPHSSRPRAWKQDLEQSLAAAYVPVVVDSKGQNPDKLRFNFYTSQYSNSLNPFYTLQKPTCGYLYRRDTDHTRKRFDVPPANLVLWRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plant Rheumatoid Arthritis Associated Nuclear Artigen (RANA) ELISA Kit
MBS9371785 Inquire

Plant Rheumatoid Arthritis Associated Nuclear Artigen (RANA) ELISA Kit

Sign In for Pricing
View Details
Esco1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6581908 1.0 µg DNA

Esco1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Recombinant Bordetella Parapertussis rph Protein (aa 1-250)
VAng-Lsx4366-500gEcoli 500 µg (E. coli)

Recombinant Bordetella Parapertussis rph Protein (aa 1-250)

Sign In for Pricing
View Details
ELISpot Plus: Hamster IFN-γ (HRP)
3102-4HPW-2 2 Plates

ELISpot Plus: Hamster IFN-γ (HRP)

Sign In for Pricing
View Details
Recombinant Human Angiomotin-like protein 2 (AMOL2)
orb3009838-01 20 µg

Recombinant Human Angiomotin-like protein 2 (AMOL2)

Sign In for Pricing
View Details
Recombinant Human Angiomotin-like protein 2 (AMOL2)
orb3009838-02 100 µg

Recombinant Human Angiomotin-like protein 2 (AMOL2)

Sign In for Pricing
View Details