Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative uncharacterized protein CCDC28A-AS1 (GVQW2)

This Recombinant Human Putative uncharacterized protein CCDC28A-AS1 (GVQW2) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative uncharacterized protein CCDC28A-AS1; GVQW motif-containing protein 2; CCDC28A-AS1 GVQW2

UniProt

A0A096LPI5

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MQYPFRKLLRPSTESCCVAQARVQWCHLGSLQPPLPGFKQFSCHSLPSSWDYRWNLTLSPRLECSGAISAHCNLCLPDLSDSPASTSRVAGTTGAHHHAQEPVVIRKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Delta Like Protein 4 (dLL4) ELISA Kit
MBS2706629-01 24 Strip Well

Rat Delta Like Protein 4 (dLL4) ELISA Kit

Sign In for Pricing
View Details
Rat Delta Like Protein 4 (dLL4) ELISA Kit
MBS2706629-02 48 Well

Rat Delta Like Protein 4 (dLL4) ELISA Kit

Sign In for Pricing
View Details
Rat Delta Like Protein 4 (dLL4) ELISA Kit
MBS2706629-03 96 Well

Rat Delta Like Protein 4 (dLL4) ELISA Kit

Sign In for Pricing
View Details
Rat Delta Like Protein 4 (dLL4) ELISA Kit
MBS2706629-04 5x 96 Well

Rat Delta Like Protein 4 (dLL4) ELISA Kit

Sign In for Pricing
View Details
Rat Delta Like Protein 4 (dLL4) ELISA Kit
MBS2706629-05 10x 96 Well

Rat Delta Like Protein 4 (dLL4) ELISA Kit

Sign In for Pricing
View Details
PSIP1 Rabbit Polyclonal Antibody (HRP)
orb2585368 100 µg

PSIP1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details