Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human LBH domain-containing protein 2 (LBHD2)

This Recombinant Human LBH domain-containing protein 2 (LBHD2) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LBH domain-containing protein 2 LBHD2

UniProt

A0A0U1RRK4

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSTPRPAPPQPGAAEGAGGPEGKAVAGAWEKGPRLGQRLPSIVVEPSEADPVESGELRWPLESAQRGPSQSRAAAAPSPSLPGEPGKAADNAGSECACSEDPAAPARG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Conjugated Human CD33 Recombinant Rabbit Monoclonal Antibody [PSH04-96]
HA720197F 100 µL

FITC Conjugated Human CD33 Recombinant Rabbit Monoclonal Antibody [PSH04-96]

Sign In for Pricing
View Details
Colupulone
TRC-C214755-5MG 5 mg

Colupulone

Sign In for Pricing
View Details
Mouse Dcp1a activation kit by CRISPRa
GA210395 1 Kit

Mouse Dcp1a activation kit by CRISPRa

Sign In for Pricing
View Details
FAK (PTK2) Rabbit Polyclonal Antibody
AP20688PU-N 100 µg

FAK (PTK2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HOXC6 (NM_004503) Human Over-expression Lysate
LC401432 20 µg

HOXC6 (NM_004503) Human Over-expression Lysate

Sign In for Pricing
View Details
G protein alpha S (GNAS) (NM_016592) Human Over-expression Lysate
LC402577 20 µg

G protein alpha S (GNAS) (NM_016592) Human Over-expression Lysate

Sign In for Pricing
View Details