Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human LBH domain-containing protein 2 (LBHD2)

This Recombinant Human LBH domain-containing protein 2 (LBHD2) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LBH domain-containing protein 2 LBHD2

UniProt

A0A0U1RRK4

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSTPRPAPPQPGAAEGAGGPEGKAVAGAWEKGPRLGQRLPSIVVEPSEADPVESGELRWPLESAQRGPSQSRAAAAPSPSLPGEPGKAADNAGSECACSEDPAAPARG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Leucyl cystinyl aminopeptidase (LNPEP) (NM_005575) Human Over-expression Lysate
LC401710 20 µg

Leucyl cystinyl aminopeptidase (LNPEP) (NM_005575) Human Over-expression Lysate

Sign In for Pricing
View Details
Human FAM3A activation kit by CRISPRa
GA111841 1 Kit

Human FAM3A activation kit by CRISPRa

Sign In for Pricing
View Details
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1964), CF568 conjugate, 0.1mg/mL
BNC681964-500 1x 500 µL

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1964), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-(3-Fluorophenyl)pyrrolidine
TRC-F594410-250MG 250 mg

2-(3-Fluorophenyl)pyrrolidine

Sign In for Pricing
View Details
GRINA (NM_000837) Human Over-expression Lysate
LY424502 100 µg

GRINA (NM_000837) Human Over-expression Lysate

Sign In for Pricing
View Details
ASB-14
TRC-A790058-5G 5 g

ASB-14

Sign In for Pricing
View Details