Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human LBH domain-containing protein 2 (LBHD2)

This Recombinant Human LBH domain-containing protein 2 (LBHD2) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LBH domain-containing protein 2 LBHD2

UniProt

A0A0U1RRK4

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSTPRPAPPQPGAAEGAGGPEGKAVAGAWEKGPRLGQRLPSIVVEPSEADPVESGELRWPLESAQRGPSQSRAAAAPSPSLPGEPGKAADNAGSECACSEDPAAPARG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Legionella Pneumophila LPC_0632 Protein (aa 1-161)
VAng-Lsx3738-1mgEcoli 1 mg (E. coli)

Recombinant Legionella Pneumophila LPC_0632 Protein (aa 1-161)

Sign In for Pricing
View Details
Chicken Chemokine C-C-Motif Ligand 17 ELISA Kit
MBS754174-01 48 Well

Chicken Chemokine C-C-Motif Ligand 17 ELISA Kit

Sign In for Pricing
View Details
Chicken Chemokine C-C-Motif Ligand 17 ELISA Kit
MBS754174-02 96 Well

Chicken Chemokine C-C-Motif Ligand 17 ELISA Kit

Sign In for Pricing
View Details
Chicken Chemokine C-C-Motif Ligand 17 ELISA Kit
MBS754174-03 5x 96 Well

Chicken Chemokine C-C-Motif Ligand 17 ELISA Kit

Sign In for Pricing
View Details
Chicken Chemokine C-C-Motif Ligand 17 ELISA Kit
MBS754174-04 10x 96 Well

Chicken Chemokine C-C-Motif Ligand 17 ELISA Kit

Sign In for Pricing
View Details
Recombinant Human MUL1 Protein, N-His
MBS1578271-01 0.1 mg

Recombinant Human MUL1 Protein, N-His

Sign In for Pricing
View Details