Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C3orf85 (CC085)

This Recombinant Human Uncharacterized protein C3orf85 (CC085) spans the amino acid sequence from region 21-90. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C3orf85 C3orf85

UniProt

A0A1B0GTC6

Expression Region

21-90

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

APFLLEDPANQFLRLKRHVNLQDYWDPDHSSDVWVNTLAKQARETWIALKTTAQYYLDMNTFTFDMSTAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEP76 (NM_024899) Human Over-expression Lysate
LS079959 100 µg

CEP76 (NM_024899) Human Over-expression Lysate

Sign In for Pricing
View Details
Human RFX2 knockdown cell line
ABC-KD12871 1 Vial

Human RFX2 knockdown cell line

Sign In for Pricing
View Details
Mouse Mfn2 (Mitofusin-2) ELISA Kit
EM7571 96 Tests

Mouse Mfn2 (Mitofusin-2) ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal TSPAN1 Antibody (4/12) [CoraFluor 1]
NBP3-12061CL1 0.1 mL

Rabbit Monoclonal TSPAN1 Antibody (4/12) [CoraFluor 1]

Sign In for Pricing
View Details
Anti-GEMIN5 Antibody
A06458 100 µL

Anti-GEMIN5 Antibody

Sign In for Pricing
View Details
Anti-Human THPO Antibody (SAA0421), FITC
FHE26011 100 Tests

Anti-Human THPO Antibody (SAA0421), FITC

Sign In for Pricing
View Details