Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small proline-rich protein 5 (SPRR5)

This Recombinant Human Small proline-rich protein 5 (SPRR5) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small proline-rich protein 5 SPRR5

UniProt

A0A1B0GTR4

Expression Region

1-108

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSQQKQKQCAPPQQCCPPPQQRCPPPQQCCPPPQQCCPPPQQCCPPPQQCCPPPQQCCPPPQQCCPPPQQYCPPPQQTKQPCQPPPKCQEPCAPKCPPPQQCQTSKQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chlorotrityl Chloride
444440-01 50 mg

Chlorotrityl Chloride

Sign In for Pricing
View Details
Chlorotrityl Chloride
444440-02 100 mg

Chlorotrityl Chloride

Sign In for Pricing
View Details
Calcitonin Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-18210R-BF555-01 20 µL

Calcitonin Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Calcitonin Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-18210R-BF555-02 100 µL

Calcitonin Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Prepro-VGF (485-503) / NERP-4 (Human, Rat, Mouse) - Cy5 Labeled Purified IgG
FC5-G-007-71 100 µL

Prepro-VGF (485-503) / NERP-4 (Human, Rat, Mouse) - Cy5 Labeled Purified IgG

Sign In for Pricing
View Details
Goat Polyclonal Goat anti-Avian IgG (H+L) Secondary Antibody [Allophycocyanin]
NB7226APC 1 mL

Goat Polyclonal Goat anti-Avian IgG (H+L) Secondary Antibody [Allophycocyanin]

Sign In for Pricing
View Details