Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein CFAP97D2 (C97D2)

This Recombinant Human Uncharacterized protein CFAP97D2 (C97D2) spans the amino acid sequence from region 1-98. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein CFAP97D2; CFAP97 domain-containing protein 2; CFAP97D2

UniProt

A0A1B0GU71

Expression Region

1-98

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MHGAPRLTFPCASEYLWHAREKAYQDHRRKVQSAQPLVDTRAPLTFRHLHLKLKRLKLEEERLSVIERDNRLLLEKVASVMRTRGQTDSKNNSKHRRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Genesig kit for Rhodococcus equi, Easy
348629 1 Kit

Genesig kit for Rhodococcus equi, Easy

Sign In for Pricing
View Details
Rabbit Polyclonal PURB Antibody
NBP1-99779 100 µL

Rabbit Polyclonal PURB Antibody

Sign In for Pricing
View Details
Sabouraud Chloramphenicol Agar BioVeg
55941-01 100 g

Sabouraud Chloramphenicol Agar BioVeg

Sign In for Pricing
View Details
Sabouraud Chloramphenicol Agar BioVeg
55941-02 500 g

Sabouraud Chloramphenicol Agar BioVeg

Sign In for Pricing
View Details
5-Methoxy-DL-tryptophan
436857-01 100 mg

5-Methoxy-DL-tryptophan

Sign In for Pricing
View Details
5-Methoxy-DL-tryptophan
436857-02 250 mg

5-Methoxy-DL-tryptophan

Sign In for Pricing
View Details