Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 32 (SIM32), partial

This Recombinant Human Small integral membrane protein 32 (SIM32), partial spans the amino acid sequence from region 1-54. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 32 SMIM32

UniProt

A0A1B0GUA5

Expression Region

1-54

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MYGDIFNATGGPEAAVGSALAPGATVKAEGALPLELATARGMRDGAATKPDLPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMPPE Human Gene Knockout Kit (CRISPR)
KN415414 1 Kit

TMPPE Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HPV-16 (Human Papilloma Virus 16) (HPV16/1295), 0.2mg/mL
BNUB1295-500 1x 500 µL

HPV-16 (Human Papilloma Virus 16) (HPV16/1295), 0.2mg/mL

Sign In for Pricing
View Details
PDZK1 Mouse Monoclonal Antibody [Clone ID: AT1A2]
AM50029PU-S 50 µL

PDZK1 Mouse Monoclonal Antibody [Clone ID: AT1A2]

Sign In for Pricing
View Details
PTPN7 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B10]
TA503714BM 100 µL

PTPN7 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B10]

Sign In for Pricing
View Details
Alpha-1-Antitrypsin (SERPINA1) (Hepatocellular & Histiocytic Marker) (AAT/3167R), CF568 conjugate, 0.1mg/mL
BNC683167-100 1x 100 µL

Alpha-1-Antitrypsin (SERPINA1) (Hepatocellular & Histiocytic Marker) (AAT/3167R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
9530002B09Rik Mouse Gene Knockout Kit (CRISPR)
KN500524 1 Kit

9530002B09Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details