Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C10orf143 (CJ143)

This Recombinant Human Uncharacterized protein C10orf143 (CJ143) spans the amino acid sequence from region 1-108. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C10orf143 C10orf143

UniProt

A0A1B0GUT2

Expression Region

1-108

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MDSLALGRWRQRRAEDLQVPGDVKRVCRRLEASGHERGCHQVNACALASWGPEDRELPSRGCLPAPRPESGQGRLSTGISQNGGRSSAQPCPRCIAGESGHFSHTKNH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PMP22 activation kit by CRISPRa
GA103630 1 Kit

Human PMP22 activation kit by CRISPRa

Sign In for Pricing
View Details
Human IL-12B p40 Recombinant Rabbit Monoclonal Antibody [PSH02-57] - BSA and Azide free (Capture)
HA721834 100 µL

Human IL-12B p40 Recombinant Rabbit Monoclonal Antibody [PSH02-57] - BSA and Azide free (Capture)

Sign In for Pricing
View Details
IL15 Mouse Monoclonal Antibody [Clone ID: OTI2B4]
CF807772 100 µg

IL15 Mouse Monoclonal Antibody [Clone ID: OTI2B4]

Sign In for Pricing
View Details
Human MRPS35 activation kit by CRISPRa
GA111855 1 Kit

Human MRPS35 activation kit by CRISPRa

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/2497R), CF405S conjugate, 0.1mg/mL
BNC042497-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/2497R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3093), CF740 conjugate, 0.1mg/mL
BNC743093-100 1x 100 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3093), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details