Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CHD9 neighbor protein (CHD9N)

This Recombinant Human CHD9 neighbor protein (CHD9N) spans the amino acid sequence from region 1-52. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CHD9 neighbor protein CHD9NB

UniProt

A0A1B0GV96

Expression Region

1-52

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCHSSKSTTVAAESQKLEEEREGREPGLETGTQAADCKDAPLKDGTPEPKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Il36rn Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV639639 1.0 µg DNA

Il36rn Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
AHA1 Protein
SPR-314B 0.1 mg

AHA1 Protein

Sign In for Pricing
View Details
LOC367157 3'UTR Luciferase Stable Cell Line
TU210054 1.0 mL

LOC367157 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Contactin-associated protein 1 (CNTNAP1) Rat ELISA Kit
C5737 96 Tests

Contactin-associated protein 1 (CNTNAP1) Rat ELISA Kit

Sign In for Pricing
View Details
IKZF4 siRNA (Human)
orb1856264-01 15 nmol

IKZF4 siRNA (Human)

Sign In for Pricing
View Details
IKZF4 siRNA (Human)
orb1856264-02 30 nmol

IKZF4 siRNA (Human)

Sign In for Pricing
View Details