Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C13orf42 (CM042)

This Recombinant Human Uncharacterized protein C13orf42 (CM042) spans the amino acid sequence from region 1-325. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C13orf42 C13orf42

UniProt

A0A1B0GVH6

Expression Region

1-325

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MFRKIHSIFNSSPQRKTAAESPFYEGASPAVKLIRSSSMYVVGDHGEKFSESLKKYKSTSSMDTSLYYLRQEEDRAWMYSRTQDCLQYLQELLALRKKYLSSFSDLKPHRTQGISSTSSKSSKGGKKTPVRSTPKEIKKATPKKYSQFSADVAEAIAFFDSIIAELDTERRPRAAEASLPNEDVDFDVATSSREHSLHSNWILRAPRRHSEDIAAHTVHTVDGQFRRSTEHRTVGTQRRLERHPIYLPKAVEGAFNTWKFKPKACKKDLGSSRQILFNFSGEDMEWDAELFALEPQLSPGEDYYETENPKGQWLLRERLWERTVP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc25a23 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6022607 1.0 µg DNA

Slc25a23 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
DFF40 Peptide
2107P 0.05 mg

DFF40 Peptide

Sign In for Pricing
View Details
Phospho-BCL2L1 (T115) Antibody
MBS7120445-01 0.05 mg

Phospho-BCL2L1 (T115) Antibody

Sign In for Pricing
View Details
Phospho-BCL2L1 (T115) Antibody
MBS7120445-02 0.1 mg

Phospho-BCL2L1 (T115) Antibody

Sign In for Pricing
View Details
Phospho-BCL2L1 (T115) Antibody
MBS7120445-03 5x 0.1 mg

Phospho-BCL2L1 (T115) Antibody

Sign In for Pricing
View Details
C3orf34 CRISPRa sgRNA lentivector (set of three targets)(Human)
14476121 3x 1.0µg DNA

C3orf34 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details