Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 200 (CC200)

This Recombinant Human Coiled-coil domain-containing protein 200 (CC200) spans the amino acid sequence from region 1-168. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 200 CCDC200

UniProt

A0A1B0GVQ3

Expression Region

1-168

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGSAYHWEARRRQMALDRRRWLMAQQQQELQQKEQELKNHQEEEQQSEEKLQPHKKLNVPQPPVAKLWTSQEQPQPSQQQPSVQPPSQPPPQPSTLPQAQVWPGPQPPQPQPPPQPTQPSAQARCTQHTSKCNLQDSQRPGLMNPCQSSPIRNTGYSQLKSTNYIQQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

nm23-H7 Double Nickase Plasmid (h2)
sc-403079-NIC-2 20 µg

nm23-H7 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
MTOR (S2442) polyclonal antibody
orb644146-01 25 µL

MTOR (S2442) polyclonal antibody

Sign In for Pricing
View Details
MTOR (S2442) polyclonal antibody
orb644146-02 50 μL

MTOR (S2442) polyclonal antibody

Sign In for Pricing
View Details
MTOR (S2442) polyclonal antibody
orb644146-03 100 µL

MTOR (S2442) polyclonal antibody

Sign In for Pricing
View Details
MTOR (S2442) polyclonal antibody
orb644146-04 200 µL

MTOR (S2442) polyclonal antibody

Sign In for Pricing
View Details
ALDOB (Aldolase B, Fructose Bisphosphate, ALDB, ALDO2) discontinued
209482-01 20 µL

ALDOB (Aldolase B, Fructose Bisphosphate, ALDB, ALDO2) discontinued

Sign In for Pricing
View Details