Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 269 (TM269), partial

This Recombinant Human Transmembrane protein 269 (TM269), partial spans the amino acid sequence from region 1-59. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 269 TMEM269

UniProt

A0A1B0GVZ9

Expression Region

1-59

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVLGLFSIIFSFSRKCHYASRMLLVSFLLDMAVRAMTSHINICSKLGAELNDFAVFTTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Brpf3 sgRNA CRISPR Lentivector set (Rat)
K6168701 3x 1.0 µg

Brpf3 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Limd1 Polyclonal Antibody, HRP Conjugated
bs-7336R-HRP 100 µL

Limd1 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
MLN Recombinant Protein (Human)
RP041356 100 µg

MLN Recombinant Protein (Human)

Sign In for Pricing
View Details
KIF2C (pS95) Antibody
abx133208-01 30 µL

KIF2C (pS95) Antibody

Sign In for Pricing
View Details
KIF2C (pS95) Antibody
abx133208-02 100 µL

KIF2C (pS95) Antibody

Sign In for Pricing
View Details
KIF2C (pS95) Antibody
abx133208-03 200 µL

KIF2C (pS95) Antibody

Sign In for Pricing
View Details