Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 269 (TM269), partial

This Recombinant Human Transmembrane protein 269 (TM269), partial spans the amino acid sequence from region 1-59. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 269 TMEM269

UniProt

A0A1B0GVZ9

Expression Region

1-59

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVLGLFSIIFSFSRKCHYASRMLLVSFLLDMAVRAMTSHINICSKLGAELNDFAVFTTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFP36 antibody
70R-21379 50 μL

ZFP36 antibody

Sign In for Pricing
View Details
DCTN2 Peptide - N-terminal region
MBS3238834-01 0.1 mg

DCTN2 Peptide - N-terminal region

Sign In for Pricing
View Details
DCTN2 Peptide - N-terminal region
MBS3238834-02 5x 0.1 mg

DCTN2 Peptide - N-terminal region

Sign In for Pricing
View Details
Boc-Met-Gln-OH
5-05952 25 g

Boc-Met-Gln-OH

Sign In for Pricing
View Details
4'-Chloro-biphenyl-3-sulfonyl chloride
sc-475166 100 mg

4'-Chloro-biphenyl-3-sulfonyl chloride

Sign In for Pricing
View Details
Heat Shock 70 kDa Protein-8 Protein
abx262434-01 2 µg

Heat Shock 70 kDa Protein-8 Protein

Sign In for Pricing
View Details