Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 269 (TM269), partial

This Recombinant Human Transmembrane protein 269 (TM269), partial spans the amino acid sequence from region 1-59. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 269 TMEM269

UniProt

A0A1B0GVZ9

Expression Region

1-59

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVLGLFSIIFSFSRKCHYASRMLLVSFLLDMAVRAMTSHINICSKLGAELNDFAVFTTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr921 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV628100 1.0 µg DNA

Olr921 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Bovine N-Terminal Pro Brain Natriuretic Peptide ELISA Kit
OM617527 96 Strip Well

Bovine N-Terminal Pro Brain Natriuretic Peptide ELISA Kit

Sign In for Pricing
View Details
Mouse Acyl-CoA Synthetase Long Chain Family Member 4 (ACSL4) ELISA Kit
abx500882-01 96 Tests

Mouse Acyl-CoA Synthetase Long Chain Family Member 4 (ACSL4) ELISA Kit

Sign In for Pricing
View Details
Mouse Acyl-CoA Synthetase Long Chain Family Member 4 (ACSL4) ELISA Kit
abx500882-02 5x 96 Tests

Mouse Acyl-CoA Synthetase Long Chain Family Member 4 (ACSL4) ELISA Kit

Sign In for Pricing
View Details
Mouse Acyl-CoA Synthetase Long Chain Family Member 4 (ACSL4) ELISA Kit
abx500882-03 10x 96 Tests

Mouse Acyl-CoA Synthetase Long Chain Family Member 4 (ACSL4) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Epsilon 1 Tubulin Antibody (7G3B2)
NBP2-37244 0.1 mL

Mouse Monoclonal Epsilon 1 Tubulin Antibody (7G3B2)

Sign In for Pricing
View Details